Q&A DiscussÔes

Any one using kaggle for AI studying?
kagglepython
0 Voto
1 Resposta
5th Sep 2017, 4:57 PM
Abhijith Krishnan
Abhijith Krishnan - avatar
How to use Kaggle to learn about Data Science?
kagglepython
1 Voto
1 Resposta
19th Apr 2019, 1:19 PM
Ádåm Tóth
Ádåm Tóth - avatar
How to use kaggle dataset in colab without downloading it
colabdatasetkagglekernalmachinelearningmlmodelpython
1 Voto
1 Resposta
10th Sep 2020, 3:56 AM
Saurabh Khade
Saurabh Khade - avatar
How to use Kaggle Datasets in Google Colab. notebook, and use them in PyTorch?
google-colabpython3pytorch
7 Votos
2 Respostas
5th Dec 2019, 7:01 AM
Aanisha Bhattacharyya
Aanisha Bhattacharyya - avatar
What do people think about Kaggle?
kagglepython
23 Votos
6 Respostas
1st May 2017, 6:17 PM
Hukilaura
Hukilaura - avatar
How to take datasets from kaggle if I wanted to use them on sololearn...as I'm using sololearn in android.
csvdatasetskagglemachinelearningpython3
2 Votos
5 Respostas
19th Oct 2021, 6:08 AM
Isha
Conways game of life output is blank on mu editor and Sololearn but shows up in Kaggle
begginerpython
0 Voto
2 Respostas
21st Sep 2021, 12:20 PM
jordan carter
jordan carter - avatar
Quente hoje
Hofstadter a sequence code coach is not running
0 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Vote Code
1 Votes
Input errors (python)
1 Votes
What’s the actual difference between MB and GB in real-world usage?
1 Votes
Without degree job
0 Votes
Script file names
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Je cherche des gens qui parle français pour apprendre le langage c
0 Votes
How can I add gradient to the background
1 Votes