Q&A Discussões

Highschool bank chanch funding unchanging of the day of the cage is for a your email to me and that you can see that it was will
while
-1 Voto
1 Resposta
27th Feb 2017, 10:22 AM
Sarthak Sajjanwar
Sarthak Sajjanwar - avatar
Как сделать форму отправляющую данные с сайта мне на email?
emailformpostsandsubmit
0 Voto
1 Resposta
15th Apr 2018, 3:55 PM
Вадим Харитонов
Вадим Харитонов - avatar
anyone in here can hack account ? cause i cnt opened my account social media. i forgot all my email nd pass. cause very long time i never log out to my account please reply guys urgent! thanks
css
1 Voto
3 Respostas
12th Feb 2017, 2:09 PM
Meida Dwi K
Meida Dwi K - avatar
Is xyz@abc.info is this a valid E-mail address?
emailhackhelpsololearnvulnerability
0 Voto
2 Respostas
23rd Jul 2017, 10:17 AM
Prashant Chauhan
PHP Submit form
emailformshtmlphpsubmit
0 Voto
1 Resposta
16th Jul 2018, 2:55 PM
Sheva
Sheva - avatar
como hacer piano
cssemailholahtmljavascript
0 Voto
2 Respostas
18th May 2017, 1:19 PM
Miguel Angel Espeso Alvarez
Miguel Angel Espeso Alvarez - avatar
How to send a result of ( my location) to an email? ( check the code in my codes called get location)
anbyemailgeolocationgetjavalocationmyscriptsend
3 Votos
9 Respostas
2nd Mar 2017, 5:11 AM
Sam Sung
Sam Sung - avatar
como hacer piano
cssemailholahtmljavascript
0 Voto
1 Resposta
18th May 2017, 1:18 PM
Miguel Angel Espeso Alvarez
Miguel Angel Espeso Alvarez - avatar
Por qué me da error al enviarlo?
correoemailformulariohtmlmailmailto
0 Voto
1 Resposta
13th Jan 2020, 9:17 PM
Cesar70
Cesar70 - avatar
How do i make an email. Box in html
5boxemailfieldfieldsethtmllegend
0 Voto
2 Respostas
19th Apr 2020, 2:42 AM
Ghostly Gamer
Ghostly Gamer - avatar
How can I send emails from SL coding playground in Java or python..?
canemailhelphowijavapythonsend
1 Voto
2 Respostas
7th Oct 2020, 5:01 PM
Haider 🥀
Haider 🥀 - avatar
PHP login system: validate mail
emailgetloginphpsafetyscriptsecurityserversystemvalidate
0 Voto
4 Respostas
14th Jul 2019, 9:54 PM
Niklas
unified index
49e:\xampp\htdocs\phplessons\inphp.phpemailinindex:linenotice:onundefined
0 Voto
2 Respostas
9th Oct 2018, 9:16 PM
Ossama Achki
Ossama Achki - avatar
NodemailerError - Invalid login: 535-5.7.8 Username and Password not accepted
clientemailformshtmljavascriptnodejsnodemailerotpserververification
2 Votos
1 Resposta
13th May 2020, 8:09 AM
777
777 - avatar
I just created sms/email marketing script. With customer and reselling portal
apibestbulksmsemailgatewaymarketingscriptsms
-3 Votos
1 Resposta
6th Aug 2018, 12:37 PM
lord_bright
lord_bright - avatar
Symmetric and Asymmetic Encyrption
asymmetriccryptographycybercybersecurityemailencyrptionreceiversecuritysendersymmetric
1 Voto
1 Resposta
25th Jan 2019, 3:33 PM
adi
adi - avatar
Mailto in HTML
emailhelphrefhtmllinkmailmailsmailtopleasepls
1 Voto
1 Resposta
15th Mar 2017, 10:54 PM
Phoenix24
< Anterior1...1011Próximo >
Quente hoje
Hofstadter a sequence code coach is not running
0 Votes
DSA doubt
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Data structure using C
0 Votes
Vote Code
1 Votes
Without degree job
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Welcome to my portfolio. Here you'll find a collection of my projects and creations. I specialize in [Your Specialization, e.g.
0 Votes
How can I add gradient to the background
0 Votes