Sesiones de PyR

Could we set the "Telephone" column as the primary key of this table, as long as it has unique values?
primarykeysql
0 Votos
3 Respuestas
24th Jan 2017, 3:36 PM
Muhammad Eloqda
Muhammad Eloqda - avatar
Generate uniqe UID and store to mysql's table
mysqlpdophpprimarykey
1 Voto
3 Respuestas
10th Mar 2019, 10:06 AM
Hamidreza Abolfathi
Hamidreza Abolfathi - avatar
Transactional replication
primarykeyrdbmsreplicationtransactionalreplication
2 Votos
1 Respuesta
27th Jul 2019, 1:27 AM
Sanjay Kamath
Sanjay Kamath - avatar
Composite primary key
compositeprimarydatabasekeyprimarykey
1 Voto
1 Respuesta
30th Jul 2019, 1:56 AM
Sanjay Kamath
Sanjay Kamath - avatar
Is anybody know how to genarate the next primary-key number automatically, stored in a data-base on my c# application.????
autogenaratec#databaseprimarykeytables
5 Votos
2 Respuestas
8th Jul 2017, 8:37 AM
Madusha Gunawardana
Madusha Gunawardana - avatar
What can be an example of a primary key in database?
databasehelphtmlitprimarykey
1 Voto
2 Respuestas
19th Sep 2020, 12:53 PM
ND BARMAN
ND BARMAN - avatar
Как удалить данные одной ячейки, если она принадлежит к столбцу, который является первичным ключём?
deletemssqlprimarykeysqlupdate
0 Votos
1 Respuesta
12th Jan 2020, 5:29 PM
Иванов Арсений Андреевич
Иванов Арсений Андреевич - avatar
What is the difference between primary and foreign key?
differencekeysmysqlprimarykeyquerysql
1 Voto
6 Respuestas
16th Jun 2017, 12:58 PM
Dani Manalang
Dani Manalang - avatar
How to insert data in a foreign key
crudcssforeignkeyhtmlmysqlnullphpprimarykeywebappxampp
0 Votos
1 Respuesta
5th May 2021, 8:42 AM
thatstupidcoder
thatstupidcoder - avatar
PHP code.. To get user_ID from one table to another, and insert automatically into to that other table (after do the PK FK)
foreignkeyjointablemysqlphpprimarykeyuserid
0 Votos
3 Respuestas
2nd Nov 2019, 10:18 AM
syasha izrina
syasha izrina - avatar
Foreign Key not visible in the PHP tables
crudcssforeignkeyhtdocshtmlmysqlphpprimarykeywebappxampp
0 Votos
1 Respuesta
5th May 2021, 8:31 AM
thatstupidcoder
thatstupidcoder - avatar
En tendencia hoy
Hofstadter a sequence code coach is not running
0 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Vote Code
1 Votes
What’s the actual difference between MB and GB in real-world usage?
1 Votes
Without degree job
0 Votes
Script file names
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Je cherche des gens qui parle français pour apprendre le langage c
0 Votes
How can I add gradient to the background
1 Votes