Sesiones de PyR

How can an image saved on your desktop be used in your website so that it can be viewed on other PCs, without having to save it?
apidesktopfileshtmlimage-viewingimagesproblemthanxweb-storagewebsites
4 Votos
4 Respuestas
31st May 2018, 8:57 AM
Siddharth
Siddharth - avatar
En tendencia hoy
Hofstadter a sequence code coach is not running
0 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Vote Code
1 Votes
What’s the actual difference between MB and GB in real-world usage?
1 Votes
Without degree job
0 Votes
Script file names
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Je cherche des gens qui parle français pour apprendre le langage c
0 Votes
How can I add gradient to the background
1 Votes