• Cursos
  • Compilador de Código
  • Debatir
  • Precios
  • Teams
Menu

Sesiones de PyR

PHP website and its database backup
backupdatabaseftphelplocalhostmysqlphpprogrammingwebsitexampp
0 Votos
14 Respuestas
8th Aug 2018, 11:49 AM
Caio De Andreis
Caio De Andreis - avatar
I made a website and I want to create it's database, can anyone tell me how to do that??
cssdatabasehtmljavascriptserver-sidewebsitexampp
1 Voto
2 Respuestas
19th Oct 2019, 2:13 PM
Anisha Gupta
Anisha Gupta - avatar
which is better Wamp or Xampp? and why ?
localhostmysqlphpphpmyadminserver-sidesqlwampxampp
1 Voto
2 Respuestas
21st Feb 2020, 10:52 AM
Zakaria Elalaoui
Zakaria Elalaoui - avatar
how to combine programming languages html, css and js on the laptop for make a website?
c#c++csshtmljavajavascriptmysqlphpxampp
1 Voto
4 Respuestas
1st Feb 2017, 2:35 PM
Ihya Ulum Addin
Ihya Ulum Addin - avatar
Any app to make front end webpages easily(gui)?
csshtmlhtml5javascriptmysqlphpwampxamppxhtmlxml
1 Voto
2 Respuestas
9th May 2018, 5:45 AM
bhumi bhumi
bhumi bhumi - avatar
Foreign Key not visible in the PHP tables
crudcssforeignkeyhtdocshtmlmysqlphpprimarykeywebappxampp
0 Votos
1 Respuesta
5th May 2021, 8:31 AM
thatstupidcoder
thatstupidcoder - avatar
< Anterior1...34Siguiente >
En tendencia hoy
Hofstadter a sequence code coach is not running
0 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Vote Code
1 Votes
Input errors (python)
1 Votes
What’s the actual difference between MB and GB in real-world usage?
1 Votes
Without degree job
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Script file names
0 Votes
Je cherche des gens qui parle français pour apprendre le langage c
0 Votes
Html learn
1 Votes