Q&A Discussions

PyQt5 webcam access using multithreading
gmapopencvpyqt5python
1 Vote
3 Answers
18th Apr 2022, 4:04 PM
Anjali Singh
Anjali Singh - avatar
How to see users webcam in html
htmljavascriptvideo-tag
0 Votes
9 Answers
3rd May 2022, 2:06 AM
Wellington N
How to Broadcast webcam data throughout clients in JavaScript?
html5javascriptnode.jsserver-sidewebcam
0 Votes
1 Answer
1st Nov 2016, 3:45 PM
sahil gupta
sahil gupta - avatar
How can I access Webcam in mobile phone with Javascript
htmljavascriptwebcam
0 Votes
1 Answer
19th Mar 2022, 3:16 AM
Arnav Gumber
Arnav Gumber - avatar
How can I make my webcam compatible to Google Chrome?
javascriptwebcam
0 Votes
1 Answer
26th Oct 2019, 7:35 PM
Vasilis Karapas
Vasilis Karapas - avatar
does anybody know how to make Webcam roulette using python?
csshtmlhtml5javascriptpython
1 Vote
1 Answer
24th Jun 2016, 7:33 PM
Bogdan Kapusta
Bogdan Kapusta - avatar
Read or scan a QR code with the webcam in javascript.
javascript
1 Vote
1 Answer
6th Sep 2019, 11:09 PM
Joyce Bissa
Joyce Bissa - avatar
Where would I begin learning how to create a cam2cam webcam application?
programmingwebcam
1 Vote
1 Answer
4th Mar 2019, 12:05 PM
Jake Serrano
Jake Serrano - avatar
Will serial communication will help programme computer hardware components such as mic, webcam
,c++python
4 Votes
1 Answer
18th Dec 2016, 6:17 AM
Isura Gayan
Isura Gayan - avatar
How can one design a code for streaming videos from a webcam using its ip address
cameraflashplayerhtmllivemysqlnetworkphpscripting-languagesstreamvideo
2 Votes
5 Answers
18th Apr 2017, 8:24 AM
ozioma ene
ozioma ene - avatar
Can I open user's webcam directly from my php page without having permission from user?
phpwebcam
-7 Votes
4 Answers
13th Oct 2017, 7:30 PM
Md. Sadiqur Rahman
HTML Tags
camhtmlhtml5webwebcam
1 Vote
1 Answer
28th Nov 2020, 2:54 PM
Senthil Kumar
Senthil Kumar - avatar
Hot today
Hofstadter a sequence code coach is not running
0 Votes
Vote Code
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Data structure using C
0 Votes
Without degree job
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Je cherche des gens qui parle français pour apprendre le langage c
0 Votes
What’s the actual difference between MB and GB in real-world usage?
1 Votes
Html learn
1 Votes