Q&A Discussions

Spherical kmeans
kmeansrrstudioskmeansspherical
0 Votes
1 Answer
27th Apr 2021, 1:38 AM
Cristian adalberto viera reyna
Cristian adalberto viera reyna - avatar
R studio, ggplot2
rproggramingrstudio
1 Vote
1 Answer
29th Mar 2020, 3:14 PM
chandni Sorathiya
R Studio
rrstudio
0 Votes
1 Answer
7th Oct 2019, 10:47 AM
Hanti Nguyen
Hanti Nguyen - avatar
How to print maximum and minimum number when you assign number in Rstudio?
rprogrammingrstudio
0 Votes
1 Answer
5th Oct 2019, 2:36 PM
Jun Jie
Jun Jie - avatar
KNN model
knnrrstudio
4 Votes
1 Answer
30th Nov 2021, 12:57 PM
Zhenis Otarbay
Zhenis Otarbay - avatar
Using Python
guiideprogrammingpythonRrstudiostarting
1 Vote
5 Answers
8th May 2017, 7:42 AM
Gareth Van Dyk
Gareth Van Dyk - avatar
About searching in dataset using python or R
daskdataframedatasetpandaspythonpython3rrstudiosearching
2 Votes
1 Answer
23rd Dec 2020, 4:19 PM
Nikita Desale
Nikita Desale - avatar
Hot today
Hofstadter a sequence code coach is not running
0 Votes
Vote Code
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Data structure using C
0 Votes
Without degree job
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
What’s the actual difference between MB and GB in real-world usage?
1 Votes
Je cherche des gens qui parle français pour apprendre le langage c
0 Votes
Html learn
1 Votes