• Courses
  • Code Compiler
  • Discuss
  • Pricing
  • Teams
Menu

Q&A Discussions

Full Stack Developer
backenddesigningfront-endfullstackmeanstackwebwebdevelopment
2 Votes
2 Answers
14th Feb 2018, 7:02 PM
Abdul Samad PA
Abdul Samad PA - avatar
Is MERN stack development is in trend ?
angularjavascriptmeanstackmernstackpythonreactwebdevelopment
1 Vote
6 Answers
6th Feb 2020, 9:46 AM
Bhavleen Singh Manaktala
Bhavleen Singh Manaktala - avatar
Best MEAN JavaScript resources?
bestjavascriptlearnmeanmeanstackresources
0 Votes
1 Answer
22nd Jun 2018, 9:12 PM
Daniel Zuluaga
Daniel Zuluaga - avatar
What is MEAN STACK development. What are best free sources to learn MEAN STACK development.
angular.jsdevelopmentexpress.jsmangodbmeanstacknode.jsweb
1 Vote
2 Answers
8th Jul 2018, 11:05 AM
Manish Bainsla
What would findOne() in mongoDB return if the record does not exists?
angularmeanmeanstackmongomongodbmongooseweb-storage
0 Votes
1 Answer
20th May 2018, 3:21 PM
Ashutosh
Ashutosh - avatar
Hot today
Hofstadter a sequence code coach is not running
0 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Vote Code
1 Votes
Input errors (python)
1 Votes
What’s the actual difference between MB and GB in real-world usage?
1 Votes
Without degree job
0 Votes
Script file names
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Je cherche des gens qui parle français pour apprendre le langage c
0 Votes
How can I add gradient to the background
1 Votes