• Courses
  • Code Compiler
  • Discuss
  • Pricing
  • Teams
Menu

Q&A Discussions

Differentiate frontend and backend languages and their relation too
angfrcripting-languagecssfrontenfrontendhtmljavajavascriptmysqlphphpscripting-languagessql
2 Votes
2 Answers
28th Jan 2018, 8:03 AM
Koushik G Shashidhar
Koushik G Shashidhar - avatar
Hot today
Hofstadter a sequence code coach is not running
0 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Vote Code
1 Votes
What’s the actual difference between MB and GB in real-world usage?
1 Votes
Without degree job
0 Votes
Script file names
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Je cherche des gens qui parle français pour apprendre le langage c
0 Votes
How can I add gradient to the background
1 Votes