Q&A Discussions

How to write bulk SMS portal script using PHP and MySQL
bulksmsmysqlphp
1 Vote
2 Answers
9th Aug 2018, 11:47 AM
Jimoh Wareez Oluwaseun
Jimoh Wareez Oluwaseun - avatar
I just created sms/email marketing script. With customer and reselling portal
apibestbulksmsemailgatewaymarketingscriptsms
-3 Votes
1 Answer
6th Aug 2018, 12:37 PM
lord_bright
lord_bright - avatar
Hot today
Hofstadter a sequence code coach is not running
0 Votes
Vote Code
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Without degree job
0 Votes
What’s the actual difference between MB and GB in real-world usage?
1 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Je cherche des gens qui parle français pour apprendre le langage c
0 Votes
Script file names
0 Votes
Html learn
1 Votes