• Courses
  • Code Compiler
  • Discuss
  • Pricing
  • Teams
Menu
0

How to modeling with petri net ?

Plz give me any cours or Book that explain how to modeling sys with petri net i have exam in this

softwaremodelingsoftwareengineeringpetrinetsystemformelle
9th May 2022, 10:46 AM
Izmiir
Izmiir - avatar
0 Answers

Often have questions like this?

Learn more efficiently, for free:

  • Introduction to Python

    7.1M learners

  • Introduction to Java

    4.7M learners

  • Introduction to C

    1.5M learners

  • Introduction to HTML

    7.5M learners

See all courses
Hot today
Hofstadter a sequence code coach is not running
0 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Vote Code
1 Votes
Input errors (python)
1 Votes
What’s the actual difference between MB and GB in real-world usage?
1 Votes
Without degree job
0 Votes
Script file names
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
Je cherche des gens qui parle français pour apprendre le langage c
0 Votes
Html learn
1 Votes