Discussions Q&R

Sklearn Bug
arraydata-typesdataframelogisticnumpypandaspythonpython3regressionsklearn
1 Vote
2 RĂ©ponses
18th Jul 2020, 9:22 AM
Clueless Coder
Clueless Coder - avatar
About searching in dataset using python or R
daskdataframedatasetpandaspythonpython3rrstudiosearching
2 Votes
1 RĂ©ponse
23rd Dec 2020, 4:19 PM
Nikita Desale
Nikita Desale - avatar
< Précédent12Suivant >
Aujourd'hui en vedette
Hofstadter a sequence code coach is not running
0 Votes
Vote Code
1 Votes
the code for bigneer is not really what to do after coding begeneer in sololearn
0 Votes
Input errors (python)
1 Votes
Without degree job
0 Votes
I wanna know is that what about dot net developers in future there is possible they gonna downfall in industry
0 Votes
What’s the actual difference between MB and GB in real-world usage?
1 Votes
Je cherche des gens qui parle français pour apprendre le langage c
0 Votes
Html learn
1 Votes
How can I add gradient to the background
0 Votes